PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr040915.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 246aa    MW: 26859.8 Da    PI: 6.0297
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr040915.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB166.63.2e-5256150195
        NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                  vreqdr++Pianv+rim+++lP +akis+daket+qecvse+i+f+t+ea+++cqre+rkt++++d+lwa+++lGf++yvepl++yl++yre e+
  Pbr040915.1  56 VREQDRYMPIANVIRIMRRILPPHAKISDDAKETMQECVSEYIAFITGEANERCQREQRKTVTAEDVLWAMGKLGFDNYVEPLTIYLQRYRESES 150
                  69******************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.1E-5053161IPR009072Histone-fold
SuperFamilySSF471135.9E-3859161IPR009072Histone-fold
PfamPF008084.7E-2562126IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.5E-1690108No hitNo description
PRINTSPR006153.5E-16109127No hitNo description
PRINTSPR006153.5E-16128146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MERMGGGLPS RHAKSWNPAN ANSSDGGNAI ANTSNPANSA GNSDNNTEQR APQCLVREQD  60
RYMPIANVIR IMRRILPPHA KISDDAKETM QECVSEYIAF ITGEANERCQ REQRKTVTAE  120
DVLWAMGKLG FDNYVEPLTI YLQRYRESES SDRSQFVKRE ERQPTDYCPP GHAVPQVAMM  180
SPPPPSYGPG YYFGPQHGPP MCDPSMMGMF RDDSSSGAGG GGSSSASGAQ GENSLGRFDP  240
FGHFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B5e-4056147192Transcription factor HapC (Eurofung)
4g91_B5e-4056147192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009346554.11e-141PREDICTED: uncharacterized protein LOC103938276
TrEMBLM5WRR41e-79M5WRR4_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.28e-60nuclear factor Y, subunit B6